PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF090100100CFD_t1
Common NameTRAES_3BF090100100CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 312aa    MW: 33029.6 Da    PI: 6.7311
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF090100100CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1016.8e-32151206358
                              -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                     WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                              Dgy+WrKYGqK +k++++prsYY+Ctsa+C++kk+ve+s++dp+++++tYeg+H h
  TRAES3BF090100100CFD_t1 151 DGYRWRKYGQKFIKNNPHPRSYYKCTSARCSAKKHVEKSTDDPEMLVVTYEGSHLH 206
                              9*****************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-30139207IPR003657WRKY domain
SuperFamilySSF1182903.01E-26148208IPR003657WRKY domain
SMARTSM007744.6E-36149208IPR003657WRKY domain
PfamPF031062.4E-26151206IPR003657WRKY domain
PROSITE profilePS5081127.921151209IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGDVLRAHDV ATTAAGDEAG VWPGELDEQL IRELLSDDSL LGSMAPPDDS ERHRSCDTGG  60
APAAAPCNSG GSIAAVHEPL PQASASSMAL CSSYSGPTIR DIEKALWSRP YTSSQRYGSL  120
YFRRYGAPGT APESRHTTKV RSCGGGKTPM DGYRWRKYGQ KFIKNNPHPR SYYKCTSARC  180
SAKKHVEKST DDPEMLVVTY EGSHLHGPQT TTLRRVQPPD AAADLPGAAG DAVAGAGIGC  240
SVRPTYGTSS GDDARREGNE PLHHGAVQRV TPTDSLASSL PHSAAAVDAT VLSSSSLDSP  300
WSLEALLPVE RI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-211512061974Probable WRKY transcription factor 4
2lex_A1e-211512061974Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3626860.0AK362686.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2009G15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753904.13e-78PREDICTED: probable WRKY transcription factor 20 isoform X1
TrEMBLA0A077RW390.0A0A077RW39_WHEAT; Uncharacterized protein
STRINGMLOC_19031.21e-136(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131442633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.21e-23WRKY DNA-binding protein 57
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]